Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q5BJC1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFGDAWKQLSWFYYQYLLVTALYMLEPWERTIFNSLLISVAAMAVYTGYVFMPQHIMAI LHYFEVVQ
Protein Names:Recommended name: Serine palmitoyltransferase small subunit A Alternative name(s): Small subunit of serine palmitoyltransferase A Short name= ssSPTa
Gene Names:Name:sptssa Synonyms:ssspta ORF Names:zgc:112487
Expression Region:1-68
Sequence Info:full length protein