Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Protein YIPF6(yipf6)

Recombinant Danio rerio Protein YIPF6(yipf6)

SKU:CSB-CF746932DIL

Regular price $1,985.00 CAD
Regular price Sale price $1,985.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6IQ85

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVSHLNRTVTSLNELFEHHAHFAGLSDISISEDIPVEGDISVPVGSQNADNDFSTLDEP VKDTILRDLRAVGQKFVHVMYPKKSSALLRDWDLWGPLLLCVTLALMLQGGSADSEEDGR PQFAEVFVIIWFGSVIITLNSKLLGGTISFFQSLCVLGYCILPLTVAMIVCRIVLLGGSG VVSFAVRLIVVTASFSWSTFASTAFLADSQPTNRKALVVYPVFLFYFVIGWMILTFSPSH

Protein Names:Recommended name: Protein YIPF6 Alternative name(s): YIP1 family member 6

Gene Names:Name:yipf6 ORF Names:zgc:86904

Expression Region:1-240

Sequence Info:full length protein

View full details