Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:A5WVU9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGKKDASSVKLPVDQYRKQIGKQDYKKTKPVLRATRLKAEAKRSAPGIRDIILVIVAVLL FLLGVYAFFYLNLSTELDLDVDMD
Protein Names:Recommended name: Protein TRIQK Alternative name(s): Triple repetitive-sequence of QXXK/R protein homolog
Gene Names:Name:triqk ORF Names:si:ch211-160k22.1
Expression Region:1-84
Sequence Info:full length protein