Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Protein reprimo B(rprmb)

Recombinant Danio rerio Protein reprimo B(rprmb)

SKU:CSB-CF764771DIL

Regular price $2,020.20 CAD
Regular price Sale price $2,020.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6PBK8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSTGFNDTDSALFSNTSFLSCCNVSSVVTDSGFVSAALDERSVFIMRTVQIAVMCVLAL TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKDVEAVIVGSY

Protein Names:Recommended name: Protein reprimo B

Gene Names:Name:rprmb Synonyms:rprm ORF Names:zgc:73361

Expression Region:1-102

Sequence Info:full length protein

View full details