Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-B(rnf144ab)

Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-B(rnf144ab)

SKU:CSB-CF715683DIL

Regular price $2,301.60 CAD
Regular price Sale price $2,301.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6DH94

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSSRYEPSWDVDLAPLLSCKLCLGEFPLEQMTTISQCQCIFCSLCLKQYVELLIKEGLE TAISCPDSACPKQGHLLENEIECMVAGEVMQHYKRLQFEREVLLDPCRTWCPSSSCQAVC QLNEAEVQLPQPVQCPECSLRFCSACRADCHTGQACQEMLPITTFLPGENGSNLKSQEDE APIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHS RASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCKRGDDDPLPT

Protein Names:Recommended name: Probable E3 ubiquitin-protein ligase RNF144A-B EC= 6.3.2.- Alternative name(s): RING finger protein 144A-B

Gene Names:Name:rnf144ab Synonyms:rnf144, rnf144a ORF Names:si:dkeyp-7f8.1, zgc:92582

Expression Region:1-293

Sequence Info:full length protein

View full details