
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P52722
Gene Names: mt
Organism: Danio rerio (Zebrafish) (Brachydanio rerio)
AA Sequence: MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ
Expression Region: 1-60aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 22 kDa
Alternative Name(s):
Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Reference: The use of metallothionein genes for determining the phylogenetic and evolutionary relationship between extant teleosts.Kille P., Olsson P.-E.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.