Gene Bio Systems
Recombinant Danio rerio Melatonin receptor type 1A-like(mtnr1al)
Recombinant Danio rerio Melatonin receptor type 1A-like(mtnr1al)
SKU:CSB-CF343120DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:P51047
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CHSLKYDKLFSNKNTVCYVILVWALTVLAIVPNWFVESLQYDPRVFSCTFAQSVSSLYTI MVVVVHFIVPIGIVTYCYLRIWILVIQVPRRVKPDSRPKIKPHDFRNFLTMFVVFVLFAV CWAPLNFIGLAVAIHPRLGQSIPEWLFTASYF
Protein Names:Recommended name: Melatonin receptor type 1A-like Short name= Mel-1A-R-like Short name= Mel1a receptor-like Alternative name(s): Melatonin receptor Mel1a Z1.4 zMel1a-2
Gene Names:Name:mtnr1al Synonyms:mel1a, mtnr1a
Expression Region:1-152
Sequence Info:full length protein
