Gene Bio Systems
Recombinant Danio rerio Heme transporter hrg1-A(slc48a1b)
Recombinant Danio rerio Heme transporter hrg1-A(slc48a1b)
SKU:CSB-CF752613DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q7T3B2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFNKTYIRVGYSCMGMLVGFSAFLVWNIAYKQPWTAAMGGLSGVLALWALVTHIMYIQD YWRTWLKGLKFFMAMGVIFSVLSIVAFISFLCVAISRQQSLTDPTSLYLSCVWSFMSLKW SFLLTLYSHRYRKEFADISILNDF
Protein Names:Recommended name: Heme transporter hrg1-A Short name= zHRG-1 Alternative name(s): Heme-responsive gene 1 protein homolog A Short name= HRG-1A Solute carrier family 48 member 1-B
Gene Names:Name:slc48a1b Synonyms:hrg1a ORF Names:zgc:63994
Expression Region:1-144
Sequence Info:full length protein
