Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)

SKU: Q9I8L5

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9I8L5

Gene Names: fabp10a

Alternative Name(s): Zf-FABP10;Zf-Lb-FABP;Fatty acid-binding protein, liver;Liver bile acid-binding protein;L-BABP;z-L-BABP;Liver-type fatty acid-binding protein;L-FABP;Liver-type FABP

Abbreviation: Recombinant Zebrafish fabp10a protein

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

Source: Yeast

Expression Region: 1-126aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MAFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI

MW: 15.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Binds hydrophobic ligands, such as cholate, in the cytoplasm. May be involved in intracellular lipid transport. Binds one cholate per subunit.

Reference:

Function: