Gene Bio Systems
Recombinant Danio rerio ER lumen protein retaining receptor 3(kdelr3)
Recombinant Danio rerio ER lumen protein retaining receptor 3(kdelr3)
SKU:CSB-CF740781DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q6PFS5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNIFRLSGDVCHLIAIIILFLKIWRSKSCAGISGKSQVLFALVFTTRYLDLFTSYISAYN TVMKVVYLLLAYSTVGLIFFRFRNSYDSESDSFRVEFLLVPVAGLSFLENYAFTPLEILW TFSIYLESVAILPQLFMITKTGEAESITAHYLLFLGLYRALYLANWLWRFHTEGFYDQIA VVSGVVQTIFYCDFFYLYFTRVLRGSGKMSLPMPV
Protein Names:Recommended name: ER lumen protein retaining receptor 3 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 3 Short name= KDEL receptor 3
Gene Names:Name:kdelr3 ORF Names:zgc:64171
Expression Region:1-215
Sequence Info:full length protein
