Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio E3 ubiquitin-protein ligase RNF185(rnf185)

Recombinant Danio rerio E3 ubiquitin-protein ligase RNF185(rnf185)

SKU:CSB-CF754238DIL

Regular price $2,156.00 CAD
Regular price Sale price $2,156.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6PC78

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASAAASESSSSSSSSSAGAANGQSAGESGGGGAQDSTFECNICLDTSKDAVISLCGHLF CWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPE NRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAAPGTPQHTDEQFLSRLF LFVALLIMFWLLIA

Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF185 EC= 6.3.2.- Alternative name(s): RING finger protein 185

Gene Names:Name:rnf185 ORF Names:zgc:73070

Expression Region:1-194

Sequence Info:full length protein

View full details