Gene Bio Systems
Recombinant Danio rerio Coiled-coil domain-containing protein 167(ccdc167)
Recombinant Danio rerio Coiled-coil domain-containing protein 167(ccdc167)
SKU:CSB-CF719319DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q5RHZ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTRTRTVKKEKISVASEIDRVEERKLQCKNSLERAEFRKRKQQLSDDDRLALEDEMTILN ERVEKYEKDLQVLRGENRRNMMLSVALLAISALFYYTFIY
Protein Names:Recommended name: Coiled-coil domain-containing protein 167
Gene Names:Name:ccdc167 ORF Names:si:ch211-214j24.7
Expression Region:1-100
Sequence Info:full length protein
