Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P0C8Y4
Gene Names: N/A
Organism: Dahlia merckii (Bedding dahlia)
AA Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC
Expression Region: 1-50aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
MW: 19.5 kDa
Alternative Name(s): Cysteine-rich antimicrobial protein 1 Defensin AMP1
Relevance: Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.
Reference: "Fungal membrane responses induced by plant defensins and thionins." Thevissen K., Ghazi A., De Samblanx G.W., Brownlee C., Osborn R.W., Broekaert W.F. J. Biol. Chem. 271:15018-15025(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.