Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyprinus carpio Granulin-3

Recombinant Cyprinus carpio Granulin-3

SKU:CSB-EP301441EQE

Regular price $1,173.42 CAD
Regular price Sale price $1,173.42 CAD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P81015

Gene Names:N/A

Organism:Cyprinus carpio (Common carp)

AA Sequence:VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR

Expression Region:1-57aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:13.3 kDa

Alternative Name(s):Granulin-3

Relevance:Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.

Reference:"Isolation and primary structure of the three major forms of granulin-like peptides from hematopoietic tissues of a teleost fish (Cyprinus carpio)." Belcourt D.R., Lazure C., Bennett H.P. J. Biol. Chem. 268:9230-9237(1993)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.

Function:Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Granulin family

Tissue Specificity:Ubiquitous.

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details