Gene Bio Systems
Recombinant Cyanothece sp. UPF0060 membrane protein PCC8801_1733 (PCC8801_1733)
Recombinant Cyanothece sp. UPF0060 membrane protein PCC8801_1733 (PCC8801_1733)
SKU:CSB-CF472521EPW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))
Uniprot NO.:B7JWT1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNIFRSLLYFFFTGLCEIGGGYLVWLWLKEGKSIKYALLGWGLLMLYGVLPALQTANFGR VYSAYGGAFVIFSLLWGWKVDRIPPDSYDWLGTLIILIGASVIMYAPRN
Protein Names:Recommended name: UPF0060 membrane protein PCC8801_1733
Gene Names:Ordered Locus Names:PCC8801_1733
Expression Region:1-109
Sequence Info:full length protein
