Gene Bio Systems
Recombinant Cyanidioschyzon merolae Photosystem I reaction center subunit XI(psaL)
Recombinant Cyanidioschyzon merolae Photosystem I reaction center subunit XI(psaL)
SKU:CSB-CF771214DZU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cyanidioschyzon merolae (Red alga)
Uniprot NO.:Q85FP8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MTDYIKPYNNDPFVGHLATPINSSSLTRAYLSQLPIYRRGVSPFLRGLEIGMAHGYFLIG PFVQLGPLRNTDIKYLAGLLSAIGLIVILTLGMLLYGAVSFTNDSQDLESVDGWRQLASG FLLGAVGGAGFAYLLLTLFS
Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L
Gene Names:Name:psaL
Expression Region:1-140
Sequence Info:full length protein
