Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cryptococcus neoformans var. neoformans serotype D Protein YOP1(YOP1)

Recombinant Cryptococcus neoformans var. neoformans serotype D Protein YOP1(YOP1)

SKU:CSB-CF316129CTL

Regular price $2,172.80 CAD
Regular price Sale price $2,172.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)

Uniprot NO.:P0CN16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAHSEQIKNNFLNNPYAQQVFNIANGQVSALDAELNKYPILRQLEQQTKVPKAYGVIAL GFSSVLLIFFNMFGLAQPISNLIGWALPAYLSILAIESPQTNDDKQWLTYWVVFGSLNLV ESMGLRAVLYWVPMYFVFKTLFTIWLMLPATRGAEILYFHFLRPMVGNVKSRSQSSFGTS DPLAKETGFNPAGTTAPSSFAHEKTL

Protein Names:Recommended name: Protein YOP1

Gene Names:Name:YOP1 Ordered Locus Names:CNF03700

Expression Region:1-206

Sequence Info:full length protein

View full details