Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cryptococcus neoformans var. neoformans serotype D Protein SYM1(SYM1)

Recombinant Cryptococcus neoformans var. neoformans serotype D Protein SYM1(SYM1)

SKU:CSB-CF316871CTK

Regular price $2,150.40 CAD
Regular price Sale price $2,150.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Uniprot NO.:P0CQ39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGLMGKYAAFLTRRPVLGNMISSAVLFGTGDVIAQQLIEKKGADHDLPRTARIVTWGGI LFAPTVNLWFRTLERIPIRSRWPATFARVGLDQFGFAPVILSGFFTAMTFMEGKDFNAAK VKWHESFFPTLQANWMLFIPFQILNMGLVPLQYRLLAVNAVNIPWNAFLSLQNAKGRKAE EDPVAISKKE

Protein Names:Recommended name: Protein SYM1

Gene Names:Name:SYM1 Ordered Locus Names:CNBA6670

Expression Region:1-190

Sequence Info:full length protein

View full details