Recombinant Coxiella burnetii Protein RnfH(rnfH)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Coxiella burnetii Protein RnfH(rnfH)

CSB-EP481560DXM
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: B6IZH9

Gene Names: rnfH

Organism: Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212))

AA Sequence: MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

Expression Region: 1-101aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.3 kDa

Alternative Name(s):

Relevance:

Reference: "Comparative genomics reveal extensive transposon-mediated genomic plasticity and diversity among potential effector proteins within the genus Coxiella."Beare P.A., Unsworth N., Andoh M., Voth D.E., Omsland A., Gilk S.D., Williams K.P., Sobral B.W., Kupko J.J. III, Porcella S.F., Samuel J.E., Heinzen R.A.Infect. Immun. 77:642-656(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share