Skip to product information
1 of 1

Gene Bio Systems

Recombinant Coxiella burnetii Probable disulfide formation protein(CBU_0888)

Recombinant Coxiella burnetii Probable disulfide formation protein(CBU_0888)

SKU:CSB-CF800838DXP

Regular price $2,086.00 CAD
Regular price Sale price $2,086.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

Uniprot NO.:Q83D55

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMVSRLLKNYSLYFAWLTALIATLGSLYLSLVRHIPVCDLCWYQRVCIYPLTILLGIAAY RTDRGVVKYALPLVVLGFLFSVYQYLQQMIPGFAPINLCGSTSPHCSEIHWEIFGFITLP FLGMLATLIMSFFLIMAFYSLDKRLAN

Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase

Gene Names:Ordered Locus Names:CBU_0888

Expression Region:1-147

Sequence Info:full length protein

View full details