Gene Bio Systems
Recombinant Corynebacterium urealyticum UPF0233 membrane protein cu0052 (cu0052)
Recombinant Corynebacterium urealyticum UPF0233 membrane protein cu0052 (cu0052)
SKU:CSB-CF540224DXD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Uniprot NO.:B1VE23
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKSKINSPEENFDSSAAAGVDRRTPVKLNASGTPRWYIVIMLGLMLLGLAWLVVNYIAG PAIPLMVTLGPWNYLIGFGLFIVGLLMTMGWK
Protein Names:Recommended name: UPF0233 membrane protein cu0052
Gene Names:Ordered Locus Names:cu0052
Expression Region:1-92
Sequence Info:full length protein
