Gene Bio Systems
Recombinant Corynebacterium glutamicum UPF0233 membrane protein Cgl0040-cg0055(Cgl0040, cg0055)
Recombinant Corynebacterium glutamicum UPF0233 membrane protein Cgl0040-cg0055(Cgl0040, cg0055)
SKU:CSB-CF847806DWY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Uniprot NO.:Q8NU99
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKARVTKNETAPVSSNPSANRTPVKINSAGTPMWYKVIMFAFMIVGLAWLIINYLVGPQ IPFMADLGAWNYGIGFGLMIIGLLMTMGWR
Protein Names:Recommended name: UPF0233 membrane protein Cgl0040/cg0055
Gene Names:Ordered Locus Names:Cgl0040, cg0055
Expression Region:1-90
Sequence Info:full length protein
