Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium glutamicum UPF0059 membrane protein cgR_1530 (cgR_1530)

Recombinant Corynebacterium glutamicum UPF0059 membrane protein cgR_1530 (cgR_1530)

SKU:CSB-CF393242CXG

Regular price $2,150.40 CAD
Regular price Sale price $2,150.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain R)

Uniprot NO.:A4QE56

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFLQIFLLSIGVAADAFACSVVRGTAIRVNLFKRALVLAGIFGVFQAAMPLIGWVIGRF FAGITFIAEIDHWIAFALLGVVGAKMIWDAFQPEDDETIVDDGRVQFRPAIILGLATSID ALAVGMGLAFVEVSILKVALSMGLITFALSLVGAWIGHHGGGKFGKWATILGGIILIGIG ANIVYEHLSA

Protein Names:Recommended name: UPF0059 membrane protein cgR_1530

Gene Names:Ordered Locus Names:cgR_1530

Expression Region:1-190

Sequence Info:full length protein

View full details