Recombinant Corynebacterium glutamicum Protein CrcB homolog 1(crcB1)

SKU: CSB-CF822840DWY

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Uniprot NO.:Q8NMM9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQKLIQGLGVGAGAALGVCVRLALTLWLGDSAWPILTINVLGAFLMGWLRPNAFWGTGFL GGFTTFSAMMLNDVSFYFFTAVGCILAWLAGDRLAR

Protein Names:Recommended name: Protein CrcB homolog 1

Gene Names:Name:crcB1 Ordered Locus Names:Cgl2542, cg2801

Expression Region:1-96

Sequence Info:full length protein