Gene Bio Systems
Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4(ctaF)
Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4(ctaF)
SKU:CSB-CF839938DWY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Uniprot NO.:Q8NNK3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKSSAKLMYGPTVFMAAMAVIYIFATMHVSDGGSVKGVEWVGSVALVLSAGLTLMLGVYL HFTEVRVDVLPEDWEEAEVADKAGTLGFFSPSSIWPAAMSGAVGFLAFGVVYFHYWMIAV GLMLLIFTITKLNLQYGVPKEKH
Protein Names:Recommended name: Cytochrome c oxidase polypeptide 4 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 4 Cytochrome c oxidase polypeptide IV
Gene Names:Name:ctaF Ordered Locus Names:Cgl2194, cg2408
Expression Region:1-143
Sequence Info:full length protein
