Gene Bio Systems
Recombinant Corynebacterium aurimucosum UPF0233 membrane protein cauri_0028 (cauri_0028)
Recombinant Corynebacterium aurimucosum UPF0233 membrane protein cauri_0028 (cauri_0028)
SKU:CSB-CF503633DWX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans)
Uniprot NO.:C3PE99
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKSKITTEGSALPQSSSSATNRTPVKINSEGTPKWYIAIMLGLMLLGLLWLVVNYLAGE SIPFMQELGPWNYGIGFGLAIIGLLMTMGWR
Protein Names:Recommended name: UPF0233 membrane protein cauri_0028
Gene Names:Ordered Locus Names:cauri_0028
Expression Region:1-91
Sequence Info:full length protein
