Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Allergen
Uniprot ID: Q08407
Gene Names: N/A
Organism: Corylus avellana (European hazel) (Corylus maxima)
AA Sequence: GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Expression Region: 2-160aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 33.4 kDa
Alternative Name(s): Allergen Cor a I Allergen: Cor a 1
Relevance:
Reference: "Four recombinant isoforms of Cor a I, the major allergen of hazel pollen, show different IgE-binding properties."Breiteneder H., Ferreira F., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Rumpold H., Kraft D., Scheiner O.Eur. J. Biochem. 212:355-362(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.