Recombinant Corylus avellana Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16

Recombinant Corylus avellana Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16

CSB-EP2008CBAD
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: Q08407

Gene Names: N/A

Organism: Corylus avellana (European hazel) (Corylus maxima)

AA Sequence: GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

Expression Region: 2-160aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.4 kDa

Alternative Name(s): Allergen Cor a I Allergen: Cor a 1

Relevance:

Reference: "Four recombinant isoforms of Cor a I, the major allergen of hazel pollen, show different IgE-binding properties."Breiteneder H., Ferreira F., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Rumpold H., Kraft D., Scheiner O.Eur. J. Biochem. 212:355-362(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share