Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Allergen
Uniprot ID: D0PWG2
Gene Names: N/A
Organism: Corylus avellana (European hazel) (Corylus maxima)
AA Sequence: FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF
Expression Region: 23-147aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 30.9 kDa
Alternative Name(s):
Relevance:
Reference: "Isolation, cloning, and characterization of 2S albumin, a new hazelnut allergen."Garino C., Zuidmeer L., Marsh J., Morati M., Versteeg S., Brettlova V., Schilte P., Shewry P., Arlorio M., van Ree R.Submitted (OCT-2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.