Skip to product information
1 of 1

Gene Bio Systems

Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP23(TVP23)

Recombinant Coccidioides immitis Golgi apparatus membrane protein TVP23(TVP23)

SKU:CSB-CF626904DUV

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Coccidioides immitis (strain RS) (Valley fever fungus)

Uniprot NO.:Q1E9X9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQQRTGDLNWRLSAHPITLLFFLGFRIGSLLMYLFGVLFISDFVLVFILTLLLLSADFY YLKNIAGRRLVGLRWWNEVNTSTGDSNWVFESSDPNTRTINATDKRFFWLSLYATPALWI GLAILAIIRLQSVIWLSLVGIALILTVTNTLAFSRCDRFSQASTFASSALSGGITSNLTR GVFGRLFR

Protein Names:Recommended name: Golgi apparatus membrane protein TVP23

Gene Names:Name:TVP23 ORF Names:CIMG_00634

Expression Region:1-188

Sequence Info:full length protein

View full details