Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)

Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)

SKU:CSB-CF384021DUT

Regular price $2,171.40 CAD
Regular price Sale price $2,171.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clostridium thermocellum (strain ATCC 27405 / DSM 1237)

Uniprot NO.:A3DHI6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGIVNSGLFNWLILPLLIFFSRIIDVTIGTIRIIFVSRGKKYLAPVLGFFEVLVWIMAI SQIMQNLNNFVCYFAYAAGFATGTFVGIIIEEKLAIGTLVIRVIVDKNECELKERLSKSG FGVTVVDAKGKNGDVKIIYTIIKRKELQEVVRIIEECNSKAFYSIEDARKVNQGIFRTGT SNHDGTRFFNLFRIHRMSGLDKKTR

Protein Names:Recommended name: UPF0316 protein Cthe_2213

Gene Names:Ordered Locus Names:Cthe_2213

Expression Region:1-205

Sequence Info:full length protein

View full details