Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium thermocellum UPF0059 membrane protein Cthe_1420 (Cthe_1420)

Recombinant Clostridium thermocellum UPF0059 membrane protein Cthe_1420 (Cthe_1420)

SKU:CSB-CF386392DUT

Regular price $2,161.60 CAD
Regular price Sale price $2,161.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium thermocellum (strain ATCC 27405 / DSM 1237)

Uniprot NO.:A3DFC2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSIELLIIAVGLSMDAFAVAICKGLSMKKMSYRNAVLTGCFFGGFQALMPLLGYLLGTQ FKDYITSIDHWIAFGLLSLIGINMIKESKNTCEITDEDDTFSLKSLTVMAFATSIDALAI GVTFAFLQVNIIPAVTMIGITTFTFSFLGVKIGNLFGVKFQSKAEIVGGLILIGMGCKIL FDHLGVISFVFDSLNKFN

Protein Names:Recommended name: UPF0059 membrane protein Cthe_1420

Gene Names:Ordered Locus Names:Cthe_1420

Expression Region:1-198

Sequence Info:full length protein

View full details