Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium perfringens UPF0059 membrane protein CPR_0503(CPR_0503)

Recombinant Clostridium perfringens UPF0059 membrane protein CPR_0503(CPR_0503)

SKU:CSB-CF612833CAAP

Regular price $2,184.00 CAD
Regular price Sale price $2,184.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium perfringens (strain SM101 / Type A)

Uniprot NO.:Q0SVL9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSILSIVLTGFGLAMDAFAVSVAKGITLTRVKAKDALKVALFFGGFQALMPLIGWGAGRY FADYIKAFDHWIAFILLGFIGGKMIFEALKEEDEEKAEVAVSMEVNKNKEREFANMKRKE ELSAKNLTVLAIATSIDALAVGVSFAFLGISIVQTIIIIGIITFVLCFLGVIIGEKLGDI FKNYAEIVGGVILILIGINILLEHTGIIEKLFS

Protein Names:Recommended name: UPF0059 membrane protein CPR_0503

Gene Names:Ordered Locus Names:CPR_0503

Expression Region:1-213

Sequence Info:full length protein

View full details