Gene Bio Systems
Recombinant Clostridium novyi Folate transporter FolT(folT)
Recombinant Clostridium novyi Folate transporter FolT(folT)
SKU:CSB-CF367739CWY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium novyi (strain NT)
Uniprot NO.:A0Q1J7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKVNVMIYMAFMITLEIVFTRFLSIQTPIIRIGFGFIPVAMSGMMFGPLLAGIVGATSD VLGMMIFPKGAYFPGFTLSAFVGAVIYGVFFYNKKVSVKRVLLAVGIITVLVNLTMNTIW LQILTGKAVKVLFVTRLVKEAIMFPIHAIVIYGAWKMVDRLEIMNKVAKFNK
Protein Names:Recommended name: Folate transporter FolT Alternative name(s): Folate ECF transporter S component FolT
Gene Names:Name:folT Ordered Locus Names:NT01CX_2426
Expression Region:1-172
Sequence Info:full length protein
