Gene Bio Systems
Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)
Recombinant Clostridium kluyveri UPF0756 membrane protein CKR_1028 (CKR_1028)
SKU:CSB-CF494680DUQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium kluyveri (strain NBRC 12016)
Uniprot NO.:B9E0Q4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESTIILIIILTASVLGRANSVALATCFLLILKLLNADKFIFPYLQENGLFLGLVILIAS ILIPIADGKVSYISIRNVFTSWLGIFALLVSLFTTYLSGLGMNYLTIQGHSEIMPALILG AVIAAAFLGGVPVGPMITSGLIALGLKLFNKIGS
Protein Names:Recommended name: UPF0756 membrane protein CKR_1028
Gene Names:Ordered Locus Names:CKR_1028
Expression Region:1-154
Sequence Info:full length protein
