Gene Bio Systems
Recombinant Clostridium cellulolyticum Cobalt transport protein CbiM(cbiM)
Recombinant Clostridium cellulolyticum Cobalt transport protein CbiM(cbiM)
SKU:CSB-CF488839DUL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Uniprot NO.:B8I0P7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGYLAPGWCISWGVMCMPFLVIGFFSIKKKIEVSSKNLTLLAMCGAFAFVLSALKM PSVTGSCSHPTGVGLGAVLFGPTAMSVIGAIILLFQAILLAHGGITTLGANVFSMAIVGP LVSFGVFKLSKRWGAKAGLAVFLAVFFGDLMTYVITSVELAMAYPDATGSFMVSLGKFIS IFGFTQVPLAVCEGLLTVVIYNVLAKYSAKELKALSAIY
Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM
Gene Names:Name:cbiM Ordered Locus Names:Ccel_1266
Expression Region:30-248
Sequence Info:full length protein
