Gene Bio Systems
Recombinant Clostridium botulinum UPF0316 protein CLB_0632 (CLB_0632)
Recombinant Clostridium botulinum UPF0316 protein CLB_0632 (CLB_0632)
SKU:CSB-CF418040CWU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium botulinum (strain ATCC 19397 / Type A)
Uniprot NO.:A7FRK3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Protein Names:Recommended name: UPF0316 protein CLB_0632
Gene Names:Ordered Locus Names:CLB_0632
Expression Region:1-170
Sequence Info:full length protein
