Gene Bio Systems
Recombinant Citrobacter koseri UPF0266 membrane protein CKO_01158 (CKO_01158)
Recombinant Citrobacter koseri UPF0266 membrane protein CKO_01158 (CKO_01158)
SKU:CSB-CF426266CWS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Uniprot NO.:A8AFN6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTVTDLVLVLFIVALLAYAIYDQFIMPRRNGPTLLAVPLLRRGRVDSVIFVGLVAILIYN NVTSHGAQITTWLLCALALMGFYIFWVRAPRIIFKQKGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLERIYKLLVSSQ
Protein Names:Recommended name: UPF0266 membrane protein CKO_01158
Gene Names:Ordered Locus Names:CKO_01158
Expression Region:1-152
Sequence Info:full length protein
