Gene Bio Systems
Recombinant Cichlasoma citrinellum Cytochrome b(mt-cyb)
Recombinant Cichlasoma citrinellum Cytochrome b(mt-cyb)
SKU:CSB-CF015075CKM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cichlasoma citrinellum (Midas cichlid)
Uniprot NO.:P69220
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TALFLAMHYTSDIATAFSSVAHICRDVNYGWLIRNMHANGASFFFICIYLHIGRGLYYGS YLYKETWNVGVVLLLLTMM
Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Gene Names:Name:mt-cyb Synonyms:cob, cytb, mtcyb
Expression Region:1-79
Sequence Info:full length protein
