1 1

Gene Bio Systems

Recombinant Chlorokybus atmophyticus ATP synthase subunit b, chloroplastic(atpF)

Recombinant Chlorokybus atmophyticus ATP synthase subunit b, chloroplastic(atpF)

CSB-CF623324CWP

$2,144.80 CAD
$2,144.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlorokybus atmophyticus (Soil alga)

Uniprot NO.:Q19VA4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MTDILTNMFTIVAELPLGEEEGFAFNGNILETNLINLAAVIGLLFYSGRSFLTNLLRNRE DNILKSIRDADERYKEATEKLQQAKNEFEQAKIEADEIRAQSRITAKEIEVSLMGLVSED TKRLIDMKQATISFEEEKAINEVRRQVIRLALQRALEQSKNRLNHRLQKRVTRLNIGLLG QLVGVND

Protein Names:Recommended name: ATP synthase subunit b, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I

Gene Names:Name:atpF

Expression Region:1-187

Sequence Info:full length protein

View full details