Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Uniprot NO.:A9WK61
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIGGLGWGELLIILIIVIAIFGAGKLAGLGGALGSSIREFRKAVKGDDEPRSDAKTEGET KV
Protein Names:Recommended name: Sec-independent protein translocase protein TatA
Gene Names:Name:tatA Ordered Locus Names:Caur_1284
Expression Region:1-62
Sequence Info:full length protein