Gene Bio Systems
Recombinant Chlamydophila psittaci Sulfur-rich protein(srp)
Recombinant Chlamydophila psittaci Sulfur-rich protein(srp)
SKU:CSB-CF329785DSM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydophila psittaci (strain ATCC VR-125 / 6BC) (Chlamydia psittaci)
Uniprot NO.:P28164
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGENANSIGSDVTSLIQPGLEQVMQDEGVQVSLINSVLGWCRVHIINPIKTSKIVQSRA FQITMVVLGIILLIAGLALTFVLQGQLGKNAFLFLIPAVIGLVKLLATSVCMEKPCTPEK WRLCKRLLATTEDILDDGQINQSNTIFTMNSSESTSASAS
Protein Names:Recommended name: Sulfur-rich protein
Gene Names:Name:srp Ordered Locus Names:CPSIT_0209, G5O_0211
Expression Region:1-160
Sequence Info:full length protein
