Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydophila caviae Probable disulfide formation protein(CCA_00587)

Recombinant Chlamydophila caviae Probable disulfide formation protein(CCA_00587)

SKU:CSB-CF800613DSL

Regular price $2,070.60 CAD
Regular price Sale price $2,070.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydophila caviae (strain GPIC)

Uniprot NO.:Q822U2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIRFLRNNALYFAWLICSTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYRE DNLVKIYALPLSITGMVIAVYQICLQEISGMTIDICGRVSCSTKLFVFGFITVPMASALA FCAISCLLILSGSKKK

Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase

Gene Names:Ordered Locus Names:CCA_00587

Expression Region:1-136

Sequence Info:full length protein

View full details