Gene Bio Systems
Recombinant Chlamydophila caviae Probable disulfide formation protein(CCA_00587)
Recombinant Chlamydophila caviae Probable disulfide formation protein(CCA_00587)
SKU:CSB-CF800613DSL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydophila caviae (strain GPIC)
Uniprot NO.:Q822U2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIRFLRNNALYFAWLICSTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYRE DNLVKIYALPLSITGMVIAVYQICLQEISGMTIDICGRVSCSTKLFVFGFITVPMASALA FCAISCLLILSGSKKK
Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase
Gene Names:Ordered Locus Names:CCA_00587
Expression Region:1-136
Sequence Info:full length protein
