Gene Bio Systems
Recombinant Chlamydomonas reinhardtii ATP synthase subunit b', chloroplastic(ATPG)
Recombinant Chlamydomonas reinhardtii ATP synthase subunit b', chloroplastic(ATPG)
SKU:CSB-CF426913DSJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydomonas reinhardtii (Chlamydomonas smithii)
Uniprot NO.:A8J785
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EAGKIFDFNLTLPVMAGEFLLLMVFLEKTWFTPVGKVLDERDNLIRSKLGSVKDNTGDVD KLVLEAETILKSARSDVSAMINTKKAAKQSELDKTYNEAKAKITAEVESSIAGLEQESAS MLKSLDAQVDKISAEVLKRVLPEGVRV
Protein Names:Recommended name: ATP synthase subunit b', chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II
Gene Names:Name:ATPG ORF Names:CHLREDRAFT_206190
Expression Region:63-209
Sequence Info:full length protein
