Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

SKU:CSB-EP316432DSB

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P0CC05

Gene Names: omcA

Organism: Chlamydia trachomatis (strain D/UW-3/Cx)

AA Sequence: CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ

Expression Region: 19-88aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 23.4 kDa

Alternative Name(s): 9KDA cysteine-rich lipoprotein Short name:9KDA-CRP

Relevance: In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).

Reference: "Cysteine-rich outer membrane proteins of Chlamydia trachomatis display compensatory sequence changes between biovariants."Allen J.E., Cerrone M.C., Beatty P.R., Stephens R.S.Mol. Microbiol. 4:1543-1550(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details