Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q98SS5
Gene Names: DCX
Organism: Gallus gallus (Chicken)
AA Sequence: MELDFGHFDERDKASRNMRGTRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANQKAPQSLASSNSAQAKENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDESECRVMKGSPAAATGSKSSPTPQKSSAKSPAPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKVDLYLPLSLDDSDSLGDSM
Expression Region: 1-361aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 44 kDa
Alternative Name(s):
Relevance:
Reference: Screening from a subtracted embryonic chick hindbrain cDNA library identification of genes expressed during hindbrain, midbrain and cranial neural crest development.Christiansen J.H., Coles E.G., Robinson V., Pasini A., Wilkinson D.G.Mech. Dev. 102:119-133(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.