Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Tetraspan membrane protein of hair cell stereocilia homolog(LHFPL5)

Recombinant Chicken Tetraspan membrane protein of hair cell stereocilia homolog(LHFPL5)

SKU:CSB-CF773656CH

Regular price $2,195.20 CAD
Regular price Sale price $2,195.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q7ZZL8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKLLPAQEAARIYHTNYVRNARAMGVLWALFTLCFSILMVVTFIQPYWIGDSIDTPQAG YFGLFSYCIGNALTGELICKGSPLDFGTIPSSAFKTAMFFVGISTFLIIGSILCFSLFFF CNAATVYKVCAWMQLAAATGLMIGCLIYPDGWDSSEVKRMCGDKTDKYTLGACTVRWAYI LCIIGILDALILSFLAFVLGNRQDNLLPSDFKVESKEEGNE

Protein Names:Recommended name: Tetraspan membrane protein of hair cell stereocilia homolog Alternative name(s): Lipoma HMGIC fusion partner-like 5 protein Peripheral myelin protein 22a

Gene Names:Name:LHFPL5 Synonyms:PMP22A, TMHS

Expression Region:1-221

Sequence Info:full length protein

View full details