Gene Bio Systems
Recombinant Chicken Tetraspan membrane protein of hair cell stereocilia homolog(LHFPL5)
Recombinant Chicken Tetraspan membrane protein of hair cell stereocilia homolog(LHFPL5)
SKU:CSB-CF773656CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q7ZZL8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKLLPAQEAARIYHTNYVRNARAMGVLWALFTLCFSILMVVTFIQPYWIGDSIDTPQAG YFGLFSYCIGNALTGELICKGSPLDFGTIPSSAFKTAMFFVGISTFLIIGSILCFSLFFF CNAATVYKVCAWMQLAAATGLMIGCLIYPDGWDSSEVKRMCGDKTDKYTLGACTVRWAYI LCIIGILDALILSFLAFVLGNRQDNLLPSDFKVESKEEGNE
Protein Names:Recommended name: Tetraspan membrane protein of hair cell stereocilia homolog Alternative name(s): Lipoma HMGIC fusion partner-like 5 protein Peripheral myelin protein 22a
Gene Names:Name:LHFPL5 Synonyms:PMP22A, TMHS
Expression Region:1-221
Sequence Info:full length protein
