Gene Bio Systems
Recombinant Chicken T-cell-specific surface glycoprotein CD28 homolog(CD28)
Recombinant Chicken T-cell-specific surface glycoprotein CD28 homolog(CD28)
SKU:CSB-CF004913CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:P31043
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ADVTENKILVAQRPLLIVANRTATLVCNYTYNGTGKEFRASLHKGTDSAVEVCFISWNMTKINSNSNKEFNCRGIHDKDKVIFNLWNMSASQTDIYFCKIEAMYPPPYVYNEKSNGTVIHVRETPIQTQEPESATSYWVMVAVTGLLGFYSMLITAVFIIYRQKSKRNRYRQSDYMNMTPRHPPHQKNKGYPSYAPTRDYTAYRSWQP
Protein Names:Recommended name: T-cell-specific surface glycoprotein CD28 homolog Alternative name(s): CHT28
Gene Names:Name:CD28
Expression Region:14-221
Sequence Info:full length protein
