Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Sodium-potassium-transporting ATPase subunit beta-1(ATP1B1)

Recombinant Chicken Sodium-potassium-transporting ATPase subunit beta-1(ATP1B1)

SKU:CSB-CF002326CH

Regular price $2,319.80 CAD
Regular price Sale price $2,319.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:P08251

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARGKANDGDGNWKKFIWNSEKKELLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTVSEFEPKYQDRVAPPGLTQVPQVQKTEISFTVNDPKSYDPYVKNLEGFLNKYSAGEQTDNIVFQDCGDIPTDYKERGPYNDAQGQKKVCKFKREWLENCSGLQDNTFGYKDGKPCILVKLNRIIGFKPKAPENESLPSDLAGKYNPYLIPVHCVAKRDEDADKIGMVEYYGMGGYPGFALQYYPYYGRLLQPQYLQPLVAVQFTNLTYDVEVRVECKEYGQNIQYSDKDRFQGRFDIKFDIKSS

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-1

Gene Names:Name:ATP1B1

Expression Region:1-305

Sequence Info:full length protein

View full details