Gene Bio Systems
Recombinant Chicken Protein cornichon homolog 2(CNIH2)
Recombinant Chicken Protein cornichon homolog 2(CNIH2)
SKU:CSB-CF673671CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q401C0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI CCLLRKLVVPEYCIHGLFCLMFLCAAEWVTLGLNLPLLLYHLWRYFHRPSDGSEGLFDAV SIMDADILGYCQKEAWCKLAFYLLSFFYYLYSMVYTLVSF
Protein Names:Recommended name: Protein cornichon homolog 2 Alternative name(s): Cornichon-like protein
Gene Names:Name:CNIH2 Synonyms:CNIL
Expression Region:1-160
Sequence Info:full length protein
