Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken PRA1 family protein 3(ARL6IP5)

Recombinant Chicken PRA1 family protein 3(ARL6IP5)

SKU:CSB-CF691663CH

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5F433

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVQVAPLRSWEDFFPGSDRFGRPDFKDISKWNNRVVNNLLYYQTNYLMVAAAVVAIVGF LSPLNMLIGGTVVILVFLGFVWVSHNKDILRRMKKQYPTTFVIVIMLSSYFLISYLGDVM VFMFGITLPLLLMFIHASLRLRNIKNKLENKKEEIGLKKTPMGIILDALEQQEDNINKLA SYIPKVKE

Protein Names:Recommended name: PRA1 family protein 3 Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 5 Short name= ARL-6-interacting protein 5 Short name= Aip-5

Gene Names:Name:ARL6IP5 Synonyms:PRAF3 ORF Names:RCJMB04_3k9

Expression Region:1-188

Sequence Info:full length protein

View full details